Lineage for d1t3eb2 (1t3e B:318-498)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 679239Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily)
    complex fold made of bifurcated and coiled b-sheets
  4. 679240Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family) (S)
  5. 679241Family b.103.1.1: MoeA N-terminal region -like [63883] (2 proteins)
  6. 679242Protein Gephyrin, domains 3 and 4 [110333] (1 species)
  7. 679243Species Rat (Rattus norvegicus) [TaxId:10116] [110334] (3 PDB entries)
  8. 679248Domain d1t3eb2: 1t3e B:318-498 [106352]
    Other proteins in same PDB: d1t3ea1, d1t3ea3, d1t3eb1, d1t3eb3
    complexed with so4

Details for d1t3eb2

PDB Entry: 1t3e (more details), 3.25 Å

PDB Description: Structural basis of dynamic glycine receptor clustering
PDB Compounds: (B:) gephyrin

SCOP Domain Sequences for d1t3eb2:

Sequence, based on SEQRES records: (download)

>d1t3eb2 b.103.1.1 (B:318-498) Gephyrin, domains 3 and 4 {Rat (Rattus norvegicus) [TaxId: 10116]}
mspfpltsmdkafitvlemtpvlgteiinyrdgmgrvlaqdvyakdnlppfpasvkdgya
vraadgpgdrfiigesqageqptqtvmpgqvmrvttgapipcgadavvqvedteliresd
dgteelevrilvqarpgqdirpighdikrgecvlakgthmgpseigllatvgvtevevnk
f

Sequence, based on observed residues (ATOM records): (download)

>d1t3eb2 b.103.1.1 (B:318-498) Gephyrin, domains 3 and 4 {Rat (Rattus norvegicus) [TaxId: 10116]}
mspfpltsmdkafitvlemtpvlgteiinyrdgmgrvlaqdvyakdnlppfpasvkdgya
vraadgpgdrfiigesqageqptqtvmpgqvmrvttgapipcgadavvqvedtvrilvqa
rpgqdirpighdikrgecvlakgthmgpseigllatvgvtevevnkf

SCOP Domain Coordinates for d1t3eb2:

Click to download the PDB-style file with coordinates for d1t3eb2.
(The format of our PDB-style files is described here.)

Timeline for d1t3eb2: