Lineage for d1t3eb2 (1t3e B:318-498)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 568864Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily)
    complex fold made of bifurcated and coiled b-sheets
  4. 568865Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family) (S)
  5. 568866Family b.103.1.1: MoeA N-terminal region -like [63883] (2 proteins)
  6. 568867Protein Gephyrin, domains 3 and 4 [110333] (1 species)
  7. 568868Species Rat (Rattus norvegicus) [TaxId:10116] [110334] (1 PDB entry)
  8. 568870Domain d1t3eb2: 1t3e B:318-498 [106352]
    Other proteins in same PDB: d1t3ea1, d1t3ea3, d1t3eb1, d1t3eb3
    complexed with so4

Details for d1t3eb2

PDB Entry: 1t3e (more details), 3.25 Å

PDB Description: Structural basis of dynamic glycine receptor clustering

SCOP Domain Sequences for d1t3eb2:

Sequence, based on SEQRES records: (download)

>d1t3eb2 b.103.1.1 (B:318-498) Gephyrin, domains 3 and 4 {Rat (Rattus norvegicus)}
mspfpltsmdkafitvlemtpvlgteiinyrdgmgrvlaqdvyakdnlppfpasvkdgya
vraadgpgdrfiigesqageqptqtvmpgqvmrvttgapipcgadavvqvedteliresd
dgteelevrilvqarpgqdirpighdikrgecvlakgthmgpseigllatvgvtevevnk
f

Sequence, based on observed residues (ATOM records): (download)

>d1t3eb2 b.103.1.1 (B:318-498) Gephyrin, domains 3 and 4 {Rat (Rattus norvegicus)}
mspfpltsmdkafitvlemtpvlgteiinyrdgmgrvlaqdvyakdnlppfpasvkdgya
vraadgpgdrfiigesqageqptqtvmpgqvmrvttgapipcgadavvqvedtvrilvqa
rpgqdirpighdikrgecvlakgthmgpseigllatvgvtevevnkf

SCOP Domain Coordinates for d1t3eb2:

Click to download the PDB-style file with coordinates for d1t3eb2.
(The format of our PDB-style files is described here.)

Timeline for d1t3eb2: