SCOPe 2.07: Domain d1t3ea3: 1t3e A:499-653

Lineage for d1t3ea3 (1t3e A:499-653)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold

4. Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families)

5. Family c.57.1.2: MoeA central domain-like [64103] (2 proteins)
   automatically mapped to Pfam PF00994

6. Protein Gephyrin, domain 5 [110647] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [110648] (3 PDB entries)
   Uniprot Q03555 350-768 # structure on the N-terminal domain (1-201) is also known (1ihc; (64101))

8. Domain d1t3ea3: 1t3e A:499-653 [106350]
   Other proteins in same PDB: d1t3ea1, d1t3ea2, d1t3eb1, d1t3eb2
   complexed with so4

Details for d1t3ea3

PDB Entry: 1t3e, 3.25 Å

PDB Description: Structural basis of dynamic glycine receptor clustering

PDB Compounds: (A:) gephyrin

SCOPe Domain Sequences for d1t3ea3:

Sequence, based on SEQRES records:

>d1t3ea3 c.57.1.2 (A:499-653) Gephyrin, domain 5 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pvvavmstgnellnpeddllpgkirdsnrstllatiqehgyptinlgivgdnpddllnal
negisradviitsggvsmgekdylkqvldidlhaqihfgrvfmkpglpttfatldidgvr
kiifalpgnpvsavvtcnlfvvpalrkmqgildpr

Sequence, based on observed residues (ATOM records):

>d1t3ea3 c.57.1.2 (A:499-653) Gephyrin, domain 5 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pvvavmstgnellnpeddllpgkirdsnrstllatiqehgyptinlgivgdnpddllnal
negisradviitsggvdylkqvldidlhaqihfgrvfmkpglpttfatldidgvrkiifa
lpgnpvsavvtcnlfvvpalrkmqgildpr

Timeline for d1t3ea3:

• d1t3ea3 first appeared in SCOP 1.69
  
• d1t3ea3 appears in SCOPe 2.06
  
• d1t3ea3 appears in the current release, SCOPe 2.08