![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily) complex fold made of bifurcated and coiled b-sheets |
![]() | Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family) ![]() automatically mapped to Pfam PF03453 |
![]() | Family b.103.1.1: MoeA N-terminal region -like [63883] (3 proteins) |
![]() | Protein Gephyrin, domains 3 and 4 [110333] (1 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [110334] (3 PDB entries) Uniprot Q03555 350-768 # structure on the N-terminal domain (1-201) is also known (1ihc; (64101)) |
![]() | Domain d1t3ea2: 1t3e A:318-498 [106349] Other proteins in same PDB: d1t3ea1, d1t3ea3, d1t3eb1, d1t3eb3 complexed with so4 |
PDB Entry: 1t3e (more details), 3.25 Å
SCOPe Domain Sequences for d1t3ea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t3ea2 b.103.1.1 (A:318-498) Gephyrin, domains 3 and 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mspfpltsmdkafitvlemtpvlgteiinyrdgmgrvlaqdvyakdnlppfpasvkdgya vraadgpgdrfiigesqageqptqtvmpgqvmrvttgapipcgadavvqvedteliresd dgteelevrilvqarpgqdirpighdikrgecvlakgthmgpseigllatvgvtevevnk f
Timeline for d1t3ea2: