Lineage for d1t3ea1 (1t3e A:654-736)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 568126Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 568335Superfamily b.85.6: MoeA C-terminal domain-like [63867] (1 family) (S)
  5. 568336Family b.85.6.1: MoeA C-terminal domain-like [63868] (2 proteins)
  6. 568337Protein Gephyrin, C-terminal domain [110330] (1 species)
  7. 568338Species Rat (Rattus norvegicus) [TaxId:10116] [110331] (1 PDB entry)
  8. 568339Domain d1t3ea1: 1t3e A:654-736 [106348]
    Other proteins in same PDB: d1t3ea2, d1t3ea3, d1t3eb2, d1t3eb3

Details for d1t3ea1

PDB Entry: 1t3e (more details), 3.25 Å

PDB Description: Structural basis of dynamic glycine receptor clustering

SCOP Domain Sequences for d1t3ea1:

Sequence, based on SEQRES records: (download)

>d1t3ea1 b.85.6.1 (A:654-736) Gephyrin, C-terminal domain {Rat (Rattus norvegicus)}
ptiikarlscdvkldprpeyhrciltwhhqeplpwaqstgnqmssrlmsmrsangllmlp
pkteqyvelhkgevvdvmvigrl

Sequence, based on observed residues (ATOM records): (download)

>d1t3ea1 b.85.6.1 (A:654-736) Gephyrin, C-terminal domain {Rat (Rattus norvegicus)}
ptiikarlscdvkldprpeyhrciltwhhqeplpwaqstgnqmslmsmrsangllmlppk
teqyvelhkgevvdvmvigrl

SCOP Domain Coordinates for d1t3ea1:

Click to download the PDB-style file with coordinates for d1t3ea1.
(The format of our PDB-style files is described here.)

Timeline for d1t3ea1: