SCOP 1.69: Domain d1t3ea1: 1t3e A:654-736

Lineage for d1t3ea1 (1t3e A:654-736)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.6: MoeA C-terminal domain-like [63867] (1 family)

5. Family b.85.6.1: MoeA C-terminal domain-like [63868] (2 proteins)

6. Protein Gephyrin, C-terminal domain [110330] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [110331] (1 PDB entry)

8. Domain d1t3ea1: 1t3e A:654-736 [106348]
   Other proteins in same PDB: d1t3ea2, d1t3ea3, d1t3eb2, d1t3eb3

Details for d1t3ea1

PDB Entry: 1t3e, 3.25 Å

PDB Description: Structural basis of dynamic glycine receptor clustering

SCOP Domain Sequences for d1t3ea1:

Sequence, based on SEQRES records:

>d1t3ea1 b.85.6.1 (A:654-736) Gephyrin, C-terminal domain {Rat (Rattus norvegicus)}
ptiikarlscdvkldprpeyhrciltwhhqeplpwaqstgnqmssrlmsmrsangllmlp
pkteqyvelhkgevvdvmvigrl

Sequence, based on observed residues (ATOM records):

>d1t3ea1 b.85.6.1 (A:654-736) Gephyrin, C-terminal domain {Rat (Rattus norvegicus)}
ptiikarlscdvkldprpeyhrciltwhhqeplpwaqstgnqmslmsmrsangllmlppk
teqyvelhkgevvdvmvigrl

Timeline for d1t3ea1:

• d1t3ea1 is new in SCOP 1.69
  
• d1t3ea1 appears in SCOP 1.71
  
• d1t3ea1 appears in the current release, SCOPe 2.08