Lineage for d1t3ea1 (1t3e A:654-736)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. Superfamily b.85.6: MoeA C-terminal domain-like [63867] (2 families) (S)
    automatically mapped to Pfam PF03454
  5. Family b.85.6.1: MoeA C-terminal domain-like [63868] (2 proteins)
  6. Protein Gephyrin, C-terminal domain [110330] (1 species)
  7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [110331] (3 PDB entries)
    Uniprot Q03555 350-768 # structure on the N-terminal domain (1-201) is also known (1ihc; (64101))
  8. Domain d1t3ea1: 1t3e A:654-736 [106348]
    Other proteins in same PDB: d1t3ea2, d1t3ea3, d1t3eb2, d1t3eb3
    complexed with so4

Details for d1t3ea1

PDB Entry: 1t3e (more details), 3.25 Å

PDB Description: Structural basis of dynamic glycine receptor clustering
PDB Compounds: (A:) gephyrin

SCOPe Domain Sequences for d1t3ea1:

Sequence, based on SEQRES records: (download)

>d1t3ea1 b.85.6.1 (A:654-736) Gephyrin, C-terminal domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ptiikarlscdvkldprpeyhrciltwhhqeplpwaqstgnqmssrlmsmrsangllmlp
pkteqyvelhkgevvdvmvigrl

Sequence, based on observed residues (ATOM records): (download)

>d1t3ea1 b.85.6.1 (A:654-736) Gephyrin, C-terminal domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ptiikarlscdvkldprpeyhrciltwhhqeplpwaqstgnqmslmsmrsangllmlppk
teqyvelhkgevvdvmvigrl

SCOPe Domain Coordinates for d1t3ea1 are not available.

Timeline for d1t3ea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t3ea2, d1t3ea3
View in 3D
Domains from other chains:
(mouse over for more information)
d1t3eb1, d1t3eb2, d1t3eb3