![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
![]() | Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (8 families) ![]() superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
![]() | Family b.81.1.6: Serine acetyltransferase [110309] (1 protein) this is a repeat family; one repeat unit is 1t3d A:205-223 found in domain |
![]() | Protein Serine acetyltransferase [110310] (2 species) extra N-terminal all-alpha subdomain belongs to Pfam PF06426 |
![]() | Species Escherichia coli [TaxId:562] [110312] (1 PDB entry) Uniprot P05796 |
![]() | Domain d1t3db_: 1t3d B: [106346] |
PDB Entry: 1t3d (more details), 2.2 Å
SCOP Domain Sequences for d1t3db_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t3db_ b.81.1.6 (B:) Serine acetyltransferase {Escherichia coli [TaxId: 562]} msceeleivwnnikaeartladcepmlasfyhatllkhenlgsalsymlanklsspimpa iairevveeayaadpemiasaacdiqavrtrdpavdkystpllylkgfhalqayrighwl wnqgrralaiflqnqvsvtfqvdihpaakigrgimldhatgivvgetaviendvsilqsv tlggtgksggdrhpkiregvmigagakilgnievgrgakigagsvvlqpvpphttaagvp arivgkpdsdkpsmdmdqhfng
Timeline for d1t3db_: