Lineage for d1t3cb_ (1t3c B:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 607530Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 607531Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 607673Family d.92.1.7: Clostridium neurotoxins, catalytic domain [55512] (1 protein)
  6. 607674Protein Botulinum neurotoxin [55513] (3 species)
  7. 607698Species Clostridium botulinum, serotype E [TaxId:1491] [111082] (2 PDB entries)
  8. 607700Domain d1t3cb_: 1t3c B: [106344]
    complexed with cl, zn; mutant

Details for d1t3cb_

PDB Entry: 1t3c (more details), 1.9 Å

PDB Description: clostridium botulinum type e catalytic domain e212q mutant

SCOP Domain Sequences for d1t3cb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t3cb_ d.92.1.7 (B:) Botulinum neurotoxin {Clostridium botulinum, serotype E}
pkinsfnyndpvndrtilyikpggcqefyksfnimkniwiipernvigttpqdfhpptsl
kngdssyydpnylqsdeekdrflkivtkifnrinnnlsggilleelskanpylgndntpd
nqfhigdasaveikfsngsqdillpnviimgaepdlfetnssnislrnnympsnhgfgsi
aivtfspeysfrfndnsmnefiqdpaltlmhqlihslhglygakgittkytitqkqnpli
tnirgtnieefltfggtdlniitsaqsndiytnlladykkiasklskvqvsnpllnpykd
vfeakygldkdasgiysvninkfndifkklysftefdlatkfqvkcrqtyigqykyfkls
nllndsiynisegyninnlkvnfrgqnanlnpriitpitgrglvkkiir

SCOP Domain Coordinates for d1t3cb_:

Click to download the PDB-style file with coordinates for d1t3cb_.
(The format of our PDB-style files is described here.)

Timeline for d1t3cb_: