Lineage for d1t3ca_ (1t3c A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 507855Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 507856Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 507998Family d.92.1.7: Clostridium neurotoxins, catalytic domain [55512] (1 protein)
  6. 507999Protein Botulinum neurotoxin [55513] (3 species)
  7. 508020Species Clostridium botulinum, serotype E [TaxId:1491] [111082] (2 PDB entries)
  8. 508021Domain d1t3ca_: 1t3c A: [106343]

Details for d1t3ca_

PDB Entry: 1t3c (more details), 1.9 Å

PDB Description: clostridium botulinum type e catalytic domain e212q mutant

SCOP Domain Sequences for d1t3ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t3ca_ d.92.1.7 (A:) Botulinum neurotoxin {Clostridium botulinum, serotype E}
pkinsfnyndpvndrtilyikpggcqefyksfnimkniwiipernvigttpqdfhpptsl
kngdssyydpnylqsdeekdrflkivtkifnrinnnlsggilleelskanpylgndntpd
nqfhigdasaveikfsngsqdillpnviimgaepdlfetnssnislrnnympsnhgfgsi
aivtfspeysfrfndnsmnefiqdpaltlmhqlihslhglygakgittkytitqkqnpli
tnirgtnieefltfggtdlniitsaqsndiytnlladykkiasklskvqvsnpllnpykd
vfeakygldkdasgiysvninkfndifkklysftefdlatkfqvkcrqtyigqykyfkls
nllndsiynisegyninnlkvnfrgqnanlnpriitpitgrglvkkiirfc

SCOP Domain Coordinates for d1t3ca_:

Click to download the PDB-style file with coordinates for d1t3ca_.
(The format of our PDB-style files is described here.)

Timeline for d1t3ca_: