| Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (15 families) ![]() |
| Family c.47.1.9: DsbC/DsbG C-terminal domain-like [52898] (2 proteins) elaborated common fold |
| Protein Disulfide bond isomerase, DsbC, C-terminal domain [52899] (2 species) |
| Species Haemophilus influenzae [TaxId:727] [110609] (1 PDB entry) |
| Domain d1t3ba1: 1t3b A:61-210 [106341] Other proteins in same PDB: d1t3ba2 |
PDB Entry: 1t3b (more details), 2.5 Å
SCOP Domain Sequences for d1t3ba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t3ba1 c.47.1.9 (A:61-210) Disulfide bond isomerase, DsbC, C-terminal domain {Haemophilus influenzae}
dvagkilvdklnsykdemivypaknekhvvtvfmditchychllhqqlkeyndlgitvry
lafpragmnnqtakqmeaiwtakdpvfalneaekgnlpkevktpnivkkhyelgiqfgvr
gtpsivtstgeliggylkpadllraleeta
Timeline for d1t3ba1: