Lineage for d1t3ab_ (1t3a B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2529349Family d.92.1.7: Clostridium neurotoxins, catalytic domain [55512] (2 proteins)
  6. 2529350Protein Botulinum neurotoxin [55513] (4 species)
  7. 2529407Species Clostridium botulinum, serotype E [TaxId:1491] [111082] (2 PDB entries)
    Uniprot Q00496 1-421
  8. 2529411Domain d1t3ab_: 1t3a B: [106340]
    complexed with cl, zn

Details for d1t3ab_

PDB Entry: 1t3a (more details), 2.16 Å

PDB Description: Crystal structure of Clostridium botulinum neurotoxin type E catalytic domain
PDB Compounds: (B:) neurotoxin type E

SCOPe Domain Sequences for d1t3ab_:

Sequence, based on SEQRES records: (download)

>d1t3ab_ d.92.1.7 (B:) Botulinum neurotoxin {Clostridium botulinum, serotype E [TaxId: 1491]}
pkinsfnyndpvndrtilyikpggcqefyksfnimkniwiipernvigttpqdfhpptsl
kngdssyydpnylqsdeekdrflkivtkifnrinnnlsggilleelskanpylgndntpd
nqfhigdasaveikfsngsqdillpnviimgaepdlfetnssnislrnnympsnhgfgsi
aivtfspeysfrfndnsmnefiqdpaltlmhelihslhglygakgittkytitqkqnpli
tnirgtnieefltfggtdlniitsaqsndiytnlladykkiasklskvqvsnpllnpykd
vfeakygldkdasgiysvninkfndifkklysftefdlatkfqvkcrqtyigqykyfkls
nllndsiynisegyninnlkvnfrgqnanlnpriitpitgrglvkkiir

Sequence, based on observed residues (ATOM records): (download)

>d1t3ab_ d.92.1.7 (B:) Botulinum neurotoxin {Clostridium botulinum, serotype E [TaxId: 1491]}
pkinsfnyndpvndrtilyikpggcqefyksfnimkniwiipernvigttpqdfhpptsl
kngdssyydpnylqsdeekdrflkivtkifnrinnnlsggilleelskanpylgndntpd
nqfhigdasaveikfsngsqdillpnviimgaepdlfetnssnislrnnympsnhgfgsi
aivtfspeysfrfndnsmnefiqdpaltlmhelihslhglygakgittkytitgtnieef
ltfggtdlniitsaqsndiytnlladykkiasklskvqvsnpllnpykdvfeakygldkd
asgiysvninkfndifkklysftefdlatkfqvkcrqtyigqykyfklsnllndsiynis
egyninnlkvnfrgqnanlnpriitpitgrglvkkiir

SCOPe Domain Coordinates for d1t3ab_:

Click to download the PDB-style file with coordinates for d1t3ab_.
(The format of our PDB-style files is described here.)

Timeline for d1t3ab_: