| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.7: Methylated DNA-protein cysteine methyltransferase domain [53155] (2 families) ![]() |
| Family c.55.7.1: Methylated DNA-protein cysteine methyltransferase domain [53156] (2 proteins) |
| Protein O6-alkylguanine-DNA alkyltransferase [53159] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [53160] (7 PDB entries) Uniprot P16455 6-176 |
| Domain d1t39a2: 1t39 A:6-91 [106336] Other proteins in same PDB: d1t39a1, d1t39b1 protein/DNA complex |
PDB Entry: 1t39 (more details), 3.3 Å
SCOPe Domain Sequences for d1t39a2:
Sequence, based on SEQRES records: (download)
>d1t39a2 c.55.7.1 (A:6-91) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens) [TaxId: 9606]}
emkrttldsplgklelsgceqglheikllgkgtsaadavevpapaavlggpeplmqctaw
lnayfhqpeaieefpvpalhhpvfqq
>d1t39a2 c.55.7.1 (A:6-91) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens) [TaxId: 9606]}
emkrttldsplgklelsgceqglheikllgpeplmqctawlnayfhqpeaieefpvpalh
hpvfqq
Timeline for d1t39a2: