Lineage for d1t39a1 (1t39 A:92-175)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 438099Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 438499Superfamily a.4.2: Methylated DNA-protein cysteine methyltransferase, C-terminal domain [46767] (1 family) (S)
  5. 438500Family a.4.2.1: Methylated DNA-protein cysteine methyltransferase, C-terminal domain [46768] (2 proteins)
  6. 438504Protein O6-alkylguanine-DNA alkyltransferase [46771] (2 species)
  7. 438507Species Human (Homo sapiens) [TaxId:9606] [46772] (6 PDB entries)
  8. 438513Domain d1t39a1: 1t39 A:92-175 [106335]
    Other proteins in same PDB: d1t39a2, d1t39b2

Details for d1t39a1

PDB Entry: 1t39 (more details), 3.3 Å

PDB Description: human o6-alkylguanine-dna alkyltransferase covalently crosslinked to dna

SCOP Domain Sequences for d1t39a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t39a1 a.4.2.1 (A:92-175) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens)}
esftrqvlwkllkvvkfgevisyqqlaalagnpkaaravggamrgnpvpilipchrvvcs
sgavgnysgglavkewllaheghr

SCOP Domain Coordinates for d1t39a1:

Click to download the PDB-style file with coordinates for d1t39a1.
(The format of our PDB-style files is described here.)

Timeline for d1t39a1:

Domains from same chain:
(mouse over for more information)
d1t39a2
Domains from other chains:
(mouse over for more information)
d1t39b1, d1t39b2