SCOP 1.71: Domain d1t38a2: 1t38 A:6-91

Lineage for d1t38a2 (1t38 A:6-91)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.7: Methylated DNA-protein cysteine methyltransferase domain [53155] (1 family)

5. Family c.55.7.1: Methylated DNA-protein cysteine methyltransferase domain [53156] (2 proteins)

6. Protein O6-alkylguanine-DNA alkyltransferase [53159] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53160] (6 PDB entries)

8. Domain d1t38a2: 1t38 A:6-91 [106334]
   Other proteins in same PDB: d1t38a1
   complexed with 6og; mutant

Details for d1t38a2

PDB Entry: 1t38, 3.2 Å

PDB Description: human o6-alkylguanine-dna alkyltransferase bound to dna containing o6- methylguanine

SCOP Domain Sequences for d1t38a2:

Sequence, based on SEQRES records:

>d1t38a2 c.55.7.1 (A:6-91) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens)}
emkrttldsplgklelsgceqglheikllgkgtsaadavevpapaavlggpeplmqctaw
lnayfhqpeaieefpvpalhhpvfqq

Sequence, based on observed residues (ATOM records):

>d1t38a2 c.55.7.1 (A:6-91) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens)}
emkrttldsplgklelsgceqglheikllgpeplmqctawlnayfhqpeaieefpvpalh
hpvfqq

Timeline for d1t38a2:

• d1t38a2 first appeared in SCOP 1.69
  
• d1t38a2 appears in SCOP 1.73
  
• d1t38a2 appears in the current release, SCOPe 2.08