Lineage for d1t38a2 (1t38 A:6-91)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2887784Superfamily c.55.7: Methylated DNA-protein cysteine methyltransferase domain [53155] (2 families) (S)
  5. 2887785Family c.55.7.1: Methylated DNA-protein cysteine methyltransferase domain [53156] (2 proteins)
  6. 2887789Protein O6-alkylguanine-DNA alkyltransferase [53159] (2 species)
  7. 2887790Species Human (Homo sapiens) [TaxId:9606] [53160] (7 PDB entries)
    Uniprot P16455 6-176
  8. 2887798Domain d1t38a2: 1t38 A:6-91 [106334]
    Other proteins in same PDB: d1t38a1
    protein/DNA complex

Details for d1t38a2

PDB Entry: 1t38 (more details), 3.2 Å

PDB Description: human o6-alkylguanine-dna alkyltransferase bound to dna containing o6- methylguanine
PDB Compounds: (A:) methylated-DNA--protein-cysteine methyltransferase

SCOPe Domain Sequences for d1t38a2:

Sequence, based on SEQRES records: (download)

>d1t38a2 c.55.7.1 (A:6-91) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens) [TaxId: 9606]}
emkrttldsplgklelsgceqglheikllgkgtsaadavevpapaavlggpeplmqctaw
lnayfhqpeaieefpvpalhhpvfqq

Sequence, based on observed residues (ATOM records): (download)

>d1t38a2 c.55.7.1 (A:6-91) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens) [TaxId: 9606]}
emkrttldsplgklelsgceqglheikllgpeplmqctawlnayfhqpeaieefpvpalh
hpvfqq

SCOPe Domain Coordinates for d1t38a2:

Click to download the PDB-style file with coordinates for d1t38a2.
(The format of our PDB-style files is described here.)

Timeline for d1t38a2: