Lineage for d1t38a1 (1t38 A:92-176)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982136Superfamily a.4.2: Methylated DNA-protein cysteine methyltransferase, C-terminal domain [46767] (2 families) (S)
    automatically mapped to Pfam PF01035
  5. 1982137Family a.4.2.1: Methylated DNA-protein cysteine methyltransferase, C-terminal domain [46768] (2 protein domains)
  6. 1982141Protein O6-alkylguanine-DNA alkyltransferase [46771] (2 species)
  7. 1982142Species Human (Homo sapiens) [TaxId:9606] [46772] (7 PDB entries)
    Uniprot P16455 6-176
  8. 1982150Domain d1t38a1: 1t38 A:92-176 [106333]
    Other proteins in same PDB: d1t38a2
    protein/DNA complex

Details for d1t38a1

PDB Entry: 1t38 (more details), 3.2 Å

PDB Description: human o6-alkylguanine-dna alkyltransferase bound to dna containing o6-methylguanine
PDB Compounds: (A:) methylated-DNA--protein-cysteine methyltransferase

SCOPe Domain Sequences for d1t38a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t38a1 a.4.2.1 (A:92-176) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens) [TaxId: 9606]}
esftrqvlwkllkvvkfgevisyqqlaalagnpkaaravggamrgnpvpilipshrvvcs
sgavgnysgglavkewllaheghrl

SCOPe Domain Coordinates for d1t38a1:

Click to download the PDB-style file with coordinates for d1t38a1.
(The format of our PDB-style files is described here.)

Timeline for d1t38a1: