SCOPe 2.08: Domain d1t38a1: 1t38 A:92-176

Lineage for d1t38a1 (1t38 A:92-176)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.2: Methylated DNA-protein cysteine methyltransferase, C-terminal domain [46767] (2 families)
   automatically mapped to Pfam PF01035

5. Family a.4.2.1: Methylated DNA-protein cysteine methyltransferase, C-terminal domain [46768] (2 proteins)

6. Protein O6-alkylguanine-DNA alkyltransferase [46771] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46772] (7 PDB entries)
   Uniprot P16455 6-176

8. Domain d1t38a1: 1t38 A:92-176 [106333]
   Other proteins in same PDB: d1t38a2
   protein/DNA complex

Details for d1t38a1

PDB Entry: 1t38, 3.2 Å

PDB Description: human o6-alkylguanine-dna alkyltransferase bound to dna containing o6- methylguanine

PDB Compounds: (A:) methylated-DNA--protein-cysteine methyltransferase

SCOPe Domain Sequences for d1t38a1:

Sequence; same for both SEQRES and ATOM records:

>d1t38a1 a.4.2.1 (A:92-176) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens) [TaxId: 9606]}
esftrqvlwkllkvvkfgevisyqqlaalagnpkaaravggamrgnpvpilipshrvvcs
sgavgnysgglavkewllaheghrl

Timeline for d1t38a1:

• d1t38a1 first appeared in SCOP 1.69
  
• d1t38a1 appears in SCOPe 2.07