Lineage for d1t36h2 (1t36 H:153-380)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 481069Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 481897Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (6 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 481898Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (9 proteins)
    contains a catalytic Cys-His-Glu triad
  6. 481909Protein Carbamoyl phosphate synthetase, small subunit C-terminal domain [52321] (1 species)
  7. 481910Species Escherichia coli [TaxId:562] [52322] (10 PDB entries)
  8. 481950Domain d1t36h2: 1t36 H:153-380 [106332]
    Other proteins in same PDB: d1t36a1, d1t36a2, d1t36a3, d1t36a4, d1t36a5, d1t36a6, d1t36b1, d1t36c1, d1t36c2, d1t36c3, d1t36c4, d1t36c5, d1t36c6, d1t36d1, d1t36e1, d1t36e2, d1t36e3, d1t36e4, d1t36e5, d1t36e6, d1t36f1, d1t36g1, d1t36g2, d1t36g3, d1t36g4, d1t36g5, d1t36g6, d1t36h1

Details for d1t36h2

PDB Entry: 1t36 (more details), 2.1 Å

PDB Description: crystal structure of e. coli carbamoyl phosphate synthetase small subunit mutant c248d complexed with uridine 5'-monophosphate

SCOP Domain Sequences for d1t36h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t36h2 c.23.16.1 (H:153-380) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli}
lngmdlakevttaeayswtqgswtltgglpeakkedelpfhvvaydfgakrnilrmlvdr
gcrltivpaqtsaedvlkmnpdgiflsngpgdpapddyaitaiqkfletdipvfgiclgh
qllalasgaktvkmkfghhggnhpvkdveknvvmitaqnhgfavdeatlpanlrvthksl
fdgtlqgihrtdkpafsfqghpeaspgphdaaplfdhfielieqyrkt

SCOP Domain Coordinates for d1t36h2:

Click to download the PDB-style file with coordinates for d1t36h2.
(The format of our PDB-style files is described here.)

Timeline for d1t36h2: