SCOP 1.71: Domain d1t36h1: 1t36 H:2-152

Lineage for d1t36h1 (1t36 H:2-152)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (9 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.3: Carbamoyl phosphate synthetase, small subunit N-terminal domain [52021] (1 family)

5. Family c.8.3.1: Carbamoyl phosphate synthetase, small subunit N-terminal domain [52022] (1 protein)

6. Protein Carbamoyl phosphate synthetase, small subunit N-terminal domain [52023] (1 species)

7. Species Escherichia coli [TaxId:562] [52024] (10 PDB entries)

8. Domain d1t36h1: 1t36 H:2-152 [106331]
   Other proteins in same PDB: d1t36a1, d1t36a2, d1t36a3, d1t36a4, d1t36a5, d1t36a6, d1t36b2, d1t36c1, d1t36c2, d1t36c3, d1t36c4, d1t36c5, d1t36c6, d1t36d2, d1t36e1, d1t36e2, d1t36e3, d1t36e4, d1t36e5, d1t36e6, d1t36f2, d1t36g1, d1t36g2, d1t36g3, d1t36g4, d1t36g5, d1t36g6, d1t36h2
   complexed with adp, cl, k, mn, net, orn, po4, u; mutant

Details for d1t36h1

PDB Entry: 1t36, 2.1 Å

PDB Description: crystal structure of e. coli carbamoyl phosphate synthetase small subunit mutant c248d complexed with uridine 5'-monophosphate

SCOP Domain Sequences for d1t36h1:

Sequence; same for both SEQRES and ATOM records:

>d1t36h1 c.8.3.1 (H:2-152) Carbamoyl phosphate synthetase, small subunit N-terminal domain {Escherichia coli}
iksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphig
nvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltrl
lrekgaqngciiagdnpdaalalekarafpg

Timeline for d1t36h1:

• d1t36h1 first appeared in SCOP 1.69
  
• d1t36h1 appears in SCOP 1.73
  
• d1t36h1 appears in the current release, SCOPe 2.08