![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.92: Carbamoyl phosphate synthetase, large subunit connection domain [48107] (1 superfamily) multihelical; consists of two all-alpha subdomains possible duplication: subdomains have similar topologies |
![]() | Superfamily a.92.1: Carbamoyl phosphate synthetase, large subunit connection domain [48108] (1 family) ![]() |
![]() | Family a.92.1.1: Carbamoyl phosphate synthetase, large subunit connection domain [48109] (1 protein) |
![]() | Protein Carbamoyl phosphate synthetase, large subunit connection domain [48110] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [48111] (10 PDB entries) |
![]() | Domain d1t36g1: 1t36 G:403-555 [106325] Other proteins in same PDB: d1t36a2, d1t36a3, d1t36a4, d1t36a5, d1t36a6, d1t36b1, d1t36b2, d1t36c2, d1t36c3, d1t36c4, d1t36c5, d1t36c6, d1t36d1, d1t36d2, d1t36e2, d1t36e3, d1t36e4, d1t36e5, d1t36e6, d1t36f1, d1t36f2, d1t36g2, d1t36g3, d1t36g4, d1t36g5, d1t36g6, d1t36h1, d1t36h2 complexed with adp, cl, k, mn, net, orn, po4, u; mutant |
PDB Entry: 1t36 (more details), 2.1 Å
SCOP Domain Sequences for d1t36g1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t36g1 a.92.1.1 (G:403-555) Carbamoyl phosphate synthetase, large subunit connection domain {Escherichia coli} evgatgfdpkvslddpealtkirrelkdagadriwyiadafraglsvdgvfnltnidrwf lvqieelvrleekvaevgitglnadflrqlkrkgfadarlaklagvreaeirklrdqydl hpvykrvdtcaaefatdtaymystyeeeceanp
Timeline for d1t36g1:
![]() Domains from other chains: (mouse over for more information) d1t36a1, d1t36a2, d1t36a3, d1t36a4, d1t36a5, d1t36a6, d1t36b1, d1t36b2, d1t36c1, d1t36c2, d1t36c3, d1t36c4, d1t36c5, d1t36c6, d1t36d1, d1t36d2, d1t36e1, d1t36e2, d1t36e3, d1t36e4, d1t36e5, d1t36e6, d1t36f1, d1t36f2, d1t36h1, d1t36h2 |