SCOPe 2.02: Domain d1t36d2: 1t36 D:153-380

Lineage for d1t36d2 (1t36 D:153-380)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins)
   contains a catalytic Cys-His-Glu triad

6. Protein Carbamoyl phosphate synthetase, small subunit C-terminal domain [52321] (1 species)

7. Species Escherichia coli [TaxId:562] [52322] (10 PDB entries)
   Uniprot P00907

8. Domain d1t36d2: 1t36 D:153-380 [106316]
   Other proteins in same PDB: d1t36a1, d1t36a2, d1t36a3, d1t36a4, d1t36a5, d1t36a6, d1t36b1, d1t36c1, d1t36c2, d1t36c3, d1t36c4, d1t36c5, d1t36c6, d1t36d1, d1t36e1, d1t36e2, d1t36e3, d1t36e4, d1t36e5, d1t36e6, d1t36f1, d1t36g1, d1t36g2, d1t36g3, d1t36g4, d1t36g5, d1t36g6, d1t36h1
   complexed with adp, cl, k, mn, net, orn, po4, u; mutant

Details for d1t36d2

PDB Entry: 1t36, 2.1 Å

PDB Description: crystal structure of e. coli carbamoyl phosphate synthetase small subunit mutant c248d complexed with uridine 5'-monophosphate

PDB Compounds: (D:) Carbamoyl-phosphate synthase small chain

SCOPe Domain Sequences for d1t36d2:

Sequence; same for both SEQRES and ATOM records:

>d1t36d2 c.23.16.1 (D:153-380) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli [TaxId: 562]}
lngmdlakevttaeayswtqgswtltgglpeakkedelpfhvvaydfgakrnilrmlvdr
gcrltivpaqtsaedvlkmnpdgiflsngpgdpapddyaitaiqkfletdipvfgiclgh
qllalasgaktvkmkfghhggnhpvkdveknvvmitaqnhgfavdeatlpanlrvthksl
fdgtlqgihrtdkpafsfqghpeaspgphdaaplfdhfielieqyrkt

Timeline for d1t36d2:

• d1t36d2 first appeared in SCOP 1.69
  
• d1t36d2 appears in SCOPe 2.01
  
• d1t36d2 appears in SCOPe 2.03
  
• d1t36d2 appears in the current release, SCOPe 2.08