Lineage for d1t36b1 (1t36 B:2-152)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 577176Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (9 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 577232Superfamily c.8.3: Carbamoyl phosphate synthetase, small subunit N-terminal domain [52021] (1 family) (S)
  5. 577233Family c.8.3.1: Carbamoyl phosphate synthetase, small subunit N-terminal domain [52022] (1 protein)
  6. 577234Protein Carbamoyl phosphate synthetase, small subunit N-terminal domain [52023] (1 species)
  7. 577235Species Escherichia coli [TaxId:562] [52024] (10 PDB entries)
  8. 577272Domain d1t36b1: 1t36 B:2-152 [106307]
    Other proteins in same PDB: d1t36a1, d1t36a2, d1t36a3, d1t36a4, d1t36a5, d1t36a6, d1t36b2, d1t36c1, d1t36c2, d1t36c3, d1t36c4, d1t36c5, d1t36c6, d1t36d2, d1t36e1, d1t36e2, d1t36e3, d1t36e4, d1t36e5, d1t36e6, d1t36f2, d1t36g1, d1t36g2, d1t36g3, d1t36g4, d1t36g5, d1t36g6, d1t36h2

Details for d1t36b1

PDB Entry: 1t36 (more details), 2.1 Å

PDB Description: crystal structure of e. coli carbamoyl phosphate synthetase small subunit mutant c248d complexed with uridine 5'-monophosphate

SCOP Domain Sequences for d1t36b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t36b1 c.8.3.1 (B:2-152) Carbamoyl phosphate synthetase, small subunit N-terminal domain {Escherichia coli}
iksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphig
nvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltrl
lrekgaqngciiagdnpdaalalekarafpg

SCOP Domain Coordinates for d1t36b1:

Click to download the PDB-style file with coordinates for d1t36b1.
(The format of our PDB-style files is described here.)

Timeline for d1t36b1: