Lineage for d1t34b_ (1t34 B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 494585Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 494586Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 494587Family c.93.1.1: L-arabinose binding protein-like [53823] (14 proteins)
  6. 494624Protein Hormone binding domain of the atrial natriuretic peptide receptor [53845] (2 species)
  7. 494629Species Rat (Rattus norvegicus) [TaxId:10116] [53846] (2 PDB entries)
  8. 494633Domain d1t34b_: 1t34 B: [106300]

Details for d1t34b_

PDB Entry: 1t34 (more details), 2.95 Å

PDB Description: rotation mechanism for transmembrane signaling by the atrial natriuretic peptide receptor

SCOP Domain Sequences for d1t34b_:

Sequence, based on SEQRES records: (download)

>d1t34b_ c.93.1.1 (B:) Hormone binding domain of the atrial natriuretic peptide receptor {Rat (Rattus norvegicus)}
sdltvavvlpltntsypwswarvgpavelalarvkarpdllpgwtvrmvlgssenaagvc
sdtaaplaavdlkwehspavflgpgcvysaapvgrftahwrvplltagapalgigvkdey
alttrtgpshvklgdfvtalhrrlgwehqalvlyadrlgddrpcffiveglymrvrerln
itvnhqefvegdpdhypkllravrrkgrviyicsspdafrnlmllalnagltgedyvffh
ldvfgqslksaqglvpqkpwergdgqdrsarqafqaakiitykepdnpeyleflkqlkll
adkkfnftvedglkniipasfhdglllyvqavtetlaqggtvtdgenitqrmwnrsfqgv
tgylkidrngdrdtdfslwdmdpetgafrvvlnyngtsqelmavsehklywplgypppdv
pkcgf

Sequence, based on observed residues (ATOM records): (download)

>d1t34b_ c.93.1.1 (B:) Hormone binding domain of the atrial natriuretic peptide receptor {Rat (Rattus norvegicus)}
sdltvavvlpltntsypwswarvgpavelalarvkarpdllpgwtvrmvlgssenaagvc
sdtaaplaavdlkwehspavflgpgcvysaapvgrftahwrvplltagapalgigvkdey
alttrtgpshvklgdfvtalhrrlgwehqalvlyadrlgddrpcffiveglymrvrerln
itvnhqefvegdpdhypkllravrrkgrviyicsspdafrnlmllalnagltgedyvffh
ldvfgqslksaqqkpwergdgqdrsarqafqaakiitykepdnpeyleflkqlklladkk
fnftvedglkniipasfhdglllyvqavtetlaqggtvtdgenitqrmwnrsfqgvtgyl
kidrngdrdtdfslwdmdpetgafrvvlnyngtsqelmavsehklywplgypppdvpkcg
f

SCOP Domain Coordinates for d1t34b_:

Click to download the PDB-style file with coordinates for d1t34b_.
(The format of our PDB-style files is described here.)

Timeline for d1t34b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1t34a_