SCOPe 2.05: Domain d1t34a_: 1t34 A:

Lineage for d1t34a_ (1t34 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)

6. Protein Hormone binding domain of the atrial natriuretic peptide receptor [53845] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [53846] (3 PDB entries)
   Uniprot P18910 29-454

8. Domain d1t34a_: 1t34 A: [106299]
   complexed with cl

Details for d1t34a_

PDB Entry: 1t34, 2.95 Å

PDB Description: rotation mechanism for transmembrane signaling by the atrial natriuretic peptide receptor

PDB Compounds: (A:) Atrial natriuretic peptide receptor A

SCOPe Domain Sequences for d1t34a_:

Sequence; same for both SEQRES and ATOM records:

>d1t34a_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Norway rat (Rattus norvegicus) [TaxId: 10116]}
sdltvavvlpltntsypwswarvgpavelalarvkarpdllpgwtvrmvlgssenaagvc
sdtaaplaavdlkwehspavflgpgcvysaapvgrftahwrvplltagapalgigvkdey
alttrtgpshvklgdfvtalhrrlgwehqalvlyadrlgddrpcffiveglymrvrerln
itvnhqefvegdpdhypkllravrrkgrviyicsspdafrnlmllalnagltgedyvffh
ldvfgqslksaqglvpqkpwergdgqdrsarqafqaakiitykepdnpeyleflkqlkll
adkkfnftvedglkniipasfhdglllyvqavtetlaqggtvtdgenitqrmwnrsfqgv
tgylkidrngdrdtdfslwdmdpetgafrvvlnyngtsqelmavsehklywplgypppdv
pkcgfd

Timeline for d1t34a_:

• d1t34a_ first appeared in SCOP 1.69
  
• d1t34a_ appears in SCOPe 2.04
  
• d1t34a_ appears in SCOPe 2.06
  
• d1t34a_ appears in the current release, SCOPe 2.08