Lineage for d1t34a_ (1t34 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912917Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2912918Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2912919Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2913008Protein Hormone binding domain of the atrial natriuretic peptide receptor [53845] (2 species)
  7. 2913013Species Norway rat (Rattus norvegicus) [TaxId:10116] [53846] (3 PDB entries)
    Uniprot P18910 29-454
  8. 2913018Domain d1t34a_: 1t34 A: [106299]
    complexed with cl

Details for d1t34a_

PDB Entry: 1t34 (more details), 2.95 Å

PDB Description: rotation mechanism for transmembrane signaling by the atrial natriuretic peptide receptor
PDB Compounds: (A:) Atrial natriuretic peptide receptor A

SCOPe Domain Sequences for d1t34a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t34a_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Norway rat (Rattus norvegicus) [TaxId: 10116]}
sdltvavvlpltntsypwswarvgpavelalarvkarpdllpgwtvrmvlgssenaagvc
sdtaaplaavdlkwehspavflgpgcvysaapvgrftahwrvplltagapalgigvkdey
alttrtgpshvklgdfvtalhrrlgwehqalvlyadrlgddrpcffiveglymrvrerln
itvnhqefvegdpdhypkllravrrkgrviyicsspdafrnlmllalnagltgedyvffh
ldvfgqslksaqglvpqkpwergdgqdrsarqafqaakiitykepdnpeyleflkqlkll
adkkfnftvedglkniipasfhdglllyvqavtetlaqggtvtdgenitqrmwnrsfqgv
tgylkidrngdrdtdfslwdmdpetgafrvvlnyngtsqelmavsehklywplgypppdv
pkcgfd

SCOPe Domain Coordinates for d1t34a_:

Click to download the PDB-style file with coordinates for d1t34a_.
(The format of our PDB-style files is described here.)

Timeline for d1t34a_: