Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (19 families) consists only of helices |
Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (34 proteins) |
Protein Putative transcriptional repressor YbiH [109655] (1 species) |
Species Salmonella typhimurium [TaxId:90371] [109656] (1 PDB entry) Uniprot Q8ZQN9 |
Domain d1t33b1: 1t33 B:7-88 [106297] Other proteins in same PDB: d1t33a2, d1t33b2 Structural genomics target |
PDB Entry: 1t33 (more details), 2.2 Å
SCOP Domain Sequences for d1t33b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t33b1 a.4.1.9 (B:7-88) Putative transcriptional repressor YbiH {Salmonella typhimurium [TaxId: 90371]} ttkgeqaksqliaaalaqfgeyglhattrdiaalagqniaaityyfgskedlylacaqwi adflgekfrphaekaerlfsqp
Timeline for d1t33b1: