Lineage for d1t33a1 (1t33 A:1-88)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 532780Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 532781Superfamily a.4.1: Homeodomain-like [46689] (13 families) (S)
    consists only of helices
  5. 533063Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (9 proteins)
  6. 533139Protein Putative transcriptional repressor YbiH [109655] (1 species)
  7. 533140Species Salmonella typhimurium [TaxId:90371] [109656] (1 PDB entry)
  8. 533141Domain d1t33a1: 1t33 A:1-88 [106295]
    Other proteins in same PDB: d1t33a2, d1t33b2

Details for d1t33a1

PDB Entry: 1t33 (more details), 2.2 Å

PDB Description: Structural Genomics, The crystal structure of a putative transcriptional repressor (TetR/AcrR family) from Salmonella typhimurim LT2

SCOP Domain Sequences for d1t33a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t33a1 a.4.1.9 (A:1-88) Putative transcriptional repressor YbiH {Salmonella typhimurium}
mnipttttkgeqaksqliaaalaqfgeyglhattrdiaalagqniaaityyfgskedlyl
acaqwiadflgekfrphaekaerlfsqp

SCOP Domain Coordinates for d1t33a1:

Click to download the PDB-style file with coordinates for d1t33a1.
(The format of our PDB-style files is described here.)

Timeline for d1t33a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t33a2