SCOP 1.75: Domain d1t2xa2: 1t2x A:1-150

Lineage for d1t2xa2 (1t2x A:1-150)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (32 families)

5. Family b.18.1.1: Galactose-binding domain [49786] (2 proteins)

6. Protein Galactose oxidase, N-terminal domain [49787] (3 species)

7. Species Dactylium dendroides [TaxId:5132] [49788] (4 PDB entries)
   Uniprot Q01745 42-680

8. Domain d1t2xa2: 1t2x A:1-150 [106293]
   Other proteins in same PDB: d1t2xa1, d1t2xa3
   complexed with act, cu, na; mutant

Details for d1t2xa2

PDB Entry: 1t2x, 2.3 Å

PDB Description: Glactose oxidase C383S mutant identified by directed evolution

PDB Compounds: (A:) Galactose oxidase

SCOP Domain Sequences for d1t2xa2:

Sequence; same for both SEQRES and ATOM records:

>d1t2xa2 b.18.1.1 (A:1-150) Galactose oxidase, N-terminal domain {Dactylium dendroides [TaxId: 5132]}
asapigsaisrnnwavtcdsaqsgnecnkaidgnkdtfwhtfygangdpkpphtytidmk
ttqnvnglsmlprqdgnqngwigrhevylssdgtnwgspvasgswfadsttkysnfetrp
aryvrlvaiteangqpwtsiaeinvfqass

Timeline for d1t2xa2:

• d1t2xa2 first appeared in SCOP 1.69
  
• d1t2xa2 appears in SCOP 1.73
  
• d1t2xa2 appears in SCOPe 2.01
  
• d1t2xa2 appears in the current release, SCOPe 2.08