Lineage for d1t2xa2 (1t2x A:1-150)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 458865Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 458866Superfamily b.18.1: Galactose-binding domain-like [49785] (24 families) (S)
  5. 458867Family b.18.1.1: Galactose-binding domain [49786] (2 proteins)
  6. 458868Protein Galactose oxidase, N-terminal domain [49787] (2 species)
  7. 458869Species Dactylium dendroides [TaxId:5132] [49788] (4 PDB entries)
  8. 458873Domain d1t2xa2: 1t2x A:1-150 [106293]
    Other proteins in same PDB: d1t2xa1, d1t2xa3

Details for d1t2xa2

PDB Entry: 1t2x (more details), 2.3 Å

PDB Description: Glactose oxidase C383S mutant identified by directed evolution

SCOP Domain Sequences for d1t2xa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t2xa2 b.18.1.1 (A:1-150) Galactose oxidase, N-terminal domain {Dactylium dendroides}
asapigsaisrnnwavtcdsaqsgnecnkaidgnkdtfwhtfygangdpkpphtytidmk
ttqnvnglsmlprqdgnqngwigrhevylssdgtnwgspvasgswfadsttkysnfetrp
aryvrlvaiteangqpwtsiaeinvfqass

SCOP Domain Coordinates for d1t2xa2:

Click to download the PDB-style file with coordinates for d1t2xa2.
(The format of our PDB-style files is described here.)

Timeline for d1t2xa2: