Lineage for d1t2xa1 (1t2x A:538-639)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 937486Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 937592Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 937712Protein Galactose oxidase, C-terminal domain [49209] (3 species)
    follows the catalytic seven-bladed beta-propeller domain
  7. 937713Species Dactylium dendroides [TaxId:5132] [49210] (8 PDB entries)
    Uniprot Q01745 42-680
  8. 937720Domain d1t2xa1: 1t2x A:538-639 [106292]
    Other proteins in same PDB: d1t2xa2, d1t2xa3
    complexed with act, cu, na; mutant

Details for d1t2xa1

PDB Entry: 1t2x (more details), 2.3 Å

PDB Description: Glactose oxidase C383S mutant identified by directed evolution
PDB Compounds: (A:) Galactose oxidase

SCOPe Domain Sequences for d1t2xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t2xa1 b.1.18.2 (A:538-639) Galactose oxidase, C-terminal domain {Dactylium dendroides [TaxId: 5132]}
gnlatrpkitrtstqsvkvggritistdssiskaslirygtathtvntdqrripltltnn
ggnsysfqvpsdsgvalpgywmlfvmnsagvpsvastirvtq

SCOPe Domain Coordinates for d1t2xa1:

Click to download the PDB-style file with coordinates for d1t2xa1.
(The format of our PDB-style files is described here.)

Timeline for d1t2xa1: