SCOPe 2.07: Domain d1t2wb_: 1t2w B:

Lineage for d1t2wb_ (1t2w B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.100: Sortase [63816] (1 superfamily)
   barrel, closed; n=8, S=10; mixed sheet; two overside connections

4. Superfamily b.100.1: Sortase [63817] (2 families)

5. Family b.100.1.1: Sortase [63818] (3 proteins)

6. Protein Sortase A [63819] (2 species)

7. Species Staphylococcus aureus [TaxId:1280] [63820] (5 PDB entries)
   Uniprot Q9S446 61-206

8. Domain d1t2wb_: 1t2w B: [106290]
   complexed with leu

Details for d1t2wb_

PDB Entry: 1t2w, 1.8 Å

PDB Description: crystal structure of sortase a in complex with a lpetg peptide

PDB Compounds: (B:) Sortase

SCOPe Domain Sequences for d1t2wb_:

Sequence, based on SEQRES records:

>d1t2wb_ b.100.1.1 (B:) Sortase A {Staphylococcus aureus [TaxId: 1280]}
ipkdkskvagyieipdadikepvypgpatpeqlnrgvsfaeeneslddqnisiaghtfid
rpnyqftnlkaakkgsmvyfkvgnetrkykmtsirdvkptdvgvldeqkgkdkqltlita
ddynektgvwekrkifvatevk

Sequence, based on observed residues (ATOM records):

>d1t2wb_ b.100.1.1 (B:) Sortase A {Staphylococcus aureus [TaxId: 1280]}
ipkdkskvagyieipdadikepvypgpatpeqlnrgvsfaeeneslddqnisiaghtfid
rpnyqftnlkaakkgsmvyfkvgnetrkykmtsirdvkptdvkqltlitaddynektgvw
ekrkifvatevk

Timeline for d1t2wb_:

• d1t2wb_ first appeared in SCOP 1.69
  
• d1t2wb_ appears in SCOPe 2.06
  
• d1t2wb_ appears in the current release, SCOPe 2.08