SCOP 1.69: Domain d1t2wb_: 1t2w B:

Lineage for d1t2wb_ (1t2w B:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.100: Sortase [63816] (1 superfamily)
   barrel, closed; n=8, S=10; mixed sheet; two overside connections

4. Superfamily b.100.1: Sortase [63817] (1 family)

5. Family b.100.1.1: Sortase [63818] (3 proteins)

6. Protein Sortase A [63819] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [63820] (4 PDB entries)

8. Domain d1t2wb_: 1t2w B: [106290]

Details for d1t2wb_

PDB Entry: 1t2w, 1.8 Å

PDB Description: crystal structure of sortase a in complex with a lpetg peptide

SCOP Domain Sequences for d1t2wb_:

Sequence, based on SEQRES records:

>d1t2wb_ b.100.1.1 (B:) Sortase A {Staphylococcus aureus}
ipkdkskvagyieipdadikepvypgpatpeqlnrgvsfaeeneslddqnisiaghtfid
rpnyqftnlkaakkgsmvyfkvgnetrkykmtsirdvkptdvgvldeqkgkdkqltlita
ddynektgvwekrkifvatevk

Sequence, based on observed residues (ATOM records):

>d1t2wb_ b.100.1.1 (B:) Sortase A {Staphylococcus aureus}
ipkdkskvagyieipdadikepvypgpatpeqlnrgvsfaeeneslddqnisiaghtfid
rpnyqftnlkaakkgsmvyfkvgnetrkykmtsirdvkptdvkqltlitaddynektgvw
ekrkifvatevk

Timeline for d1t2wb_:

• d1t2wb_ is new in SCOP 1.69
  
• d1t2wb_ appears in SCOP 1.71
  
• d1t2wb_ appears in the current release, SCOPe 2.08