SCOPe 2.07: Domain d1t2sa1: 1t2s A:5-123

Lineage for d1t2sa1 (1t2s A:5-123)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.14: PAZ domain [101690] (2 families)

5. Family b.34.14.1: PAZ domain [101691] (6 proteins)

6. Protein Argonaute 2 [101692] (2 species)
   Pfam PF16486; Pfam PF08699; Pfam PF16488

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101693] (4 PDB entries)
   Uniprot Q9VUQ5 602-717 ! Uniprot Q9VUQ5 602-720

8. Domain d1t2sa1: 1t2s A:5-123 [106287]
   Other proteins in same PDB: d1t2sa2

Details for d1t2sa1

PDB Entry: 1t2s

PDB Description: structural basis for 3' end recognition of nucleic acids by the drosophila argonaute 2 paz domain

PDB Compounds: (A:) Argonaute 2

SCOPe Domain Sequences for d1t2sa1:

Sequence; same for both SEQRES and ATOM records:

>d1t2sa1 b.34.14.1 (A:5-123) Argonaute 2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mpmieylerfslkakinnttnldysrrflepflrginvvytppqsfqsaprvyrvnglsr
apassetfehdgkkvtiasyfhsrnyplkfpqlhclnvgssiksillpielcsieegqa

Timeline for d1t2sa1:

• d1t2sa1 first appeared in SCOP 1.69, called d1t2sa_
  
• d1t2sa1 appears in SCOPe 2.06
  
• d1t2sa1 appears in the current release, SCOPe 2.08