SCOPe 2.02: Domain d1t2sa_: 1t2s A:

Lineage for d1t2sa_ (1t2s A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.14: PAZ domain [101690] (1 family)

5. Family b.34.14.1: PAZ domain [101691] (6 proteins)

6. Protein Argonaute 2 [101692] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101693] (4 PDB entries)
   Uniprot Q9VUQ5 602-717 ! Uniprot Q9VUQ5 602-720

8. Domain d1t2sa_: 1t2s A: [106287]

Details for d1t2sa_

PDB Entry: 1t2s

PDB Description: structural basis for 3' end recognition of nucleic acids by the drosophila argonaute 2 paz domain

PDB Compounds: (A:) Argonaute 2

SCOPe Domain Sequences for d1t2sa_:

Sequence; same for both SEQRES and ATOM records:

>d1t2sa_ b.34.14.1 (A:) Argonaute 2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
gamampmieylerfslkakinnttnldysrrflepflrginvvytppqsfqsaprvyrvn
glsrapassetfehdgkkvtiasyfhsrnyplkfpqlhclnvgssiksillpielcsiee
gqa

Timeline for d1t2sa_:

• d1t2sa_ first appeared in SCOP 1.69
  
• d1t2sa_ appears in SCOPe 2.01
  
• d1t2sa_ appears in SCOPe 2.03
  
• d1t2sa_ appears in the current release, SCOPe 2.08, called d1t2sa1