Class b: All beta proteins [48724] (174 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.14: PAZ domain [101690] (1 family) |
Family b.34.14.1: PAZ domain [101691] (6 proteins) |
Protein Argonaute 2 [101692] (1 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101693] (4 PDB entries) Uniprot Q9VUQ5 602-717 ! Uniprot Q9VUQ5 602-720 |
Domain d1t2sa_: 1t2s A: [106287] |
PDB Entry: 1t2s (more details)
SCOPe Domain Sequences for d1t2sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t2sa_ b.34.14.1 (A:) Argonaute 2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} gamampmieylerfslkakinnttnldysrrflepflrginvvytppqsfqsaprvyrvn glsrapassetfehdgkkvtiasyfhsrnyplkfpqlhclnvgssiksillpielcsiee gqa
Timeline for d1t2sa_: