Lineage for d1t2sa_ (1t2s A:)
- Root: SCOP 1.69
Class b: All beta proteins [48724] (144 folds) 
Fold b.34: SH3-like barrel [50036] (15 superfamilies)
barrel, partly opened; n*=4, S*=8; meander
the last strand is interrupted by a turn of 3-10 helix
Superfamily b.34.14: PAZ domain [101690] (1 family) 
Family b.34.14.1: PAZ domain [101691] (4 proteins) 
Protein Argonaute 2 [101692] (1 species) Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101693] (4 PDB entries) 
Domain d1t2sa_: 1t2s A: [106287]
Details for d1t2sa_
PDB Entry: 1t2s (more details)
PDB Description: structural basis for 3' end recognition of nucleic acids by the drosophila argonaute 2 paz domain
SCOP Domain Sequences for d1t2sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t2sa_ b.34.14.1 (A:) Argonaute 2 {Fruit fly (Drosophila melanogaster)}
gamampmieylerfslkakinnttnldysrrflepflrginvvytppqsfqsaprvyrvn
glsrapassetfehdgkkvtiasyfhsrnyplkfpqlhclnvgssiksillpielcsiee
gqa
SCOP Domain Coordinates for d1t2sa_:
Click to download the PDB-style file with coordinates for d1t2sa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1t2sa_:
- d1t2sa_ is new in SCOP 1.69
- d1t2sa_ appears in SCOP 1.71
- d1t2sa_ appears in the current release, SCOPe 2.08, called d1t2sa1
View in 3D