Lineage for d1t2ra_ (1t2r A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1785323Superfamily b.34.14: PAZ domain [101690] (1 family) (S)
  5. 1785324Family b.34.14.1: PAZ domain [101691] (6 proteins)
  6. 1785328Protein Argonaute 2 [101692] (1 species)
  7. 1785329Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101693] (4 PDB entries)
    Uniprot Q9VUQ5 602-717 ! Uniprot Q9VUQ5 602-720
  8. 1785332Domain d1t2ra_: 1t2r A: [106286]
    protein/RNA complex

Details for d1t2ra_

PDB Entry: 1t2r (more details)

PDB Description: structural basis for 3' end recognition of nucleic acids by the drosophila argonaute 2 paz domain
PDB Compounds: (A:) Argonaute 2

SCOPe Domain Sequences for d1t2ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t2ra_ b.34.14.1 (A:) Argonaute 2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
gamampmieylerfslkakinnttnldysrrflepflrginvvytppqsfqsaprvyrvn
glsrapassetfehdgkkvtiasyfhsrnyplkfpqlhclnvgssiksillpielcsiee
gqa

SCOPe Domain Coordinates for d1t2ra_:

Click to download the PDB-style file with coordinates for d1t2ra_.
(The format of our PDB-style files is described here.)

Timeline for d1t2ra_: