Lineage for d1t2ra_ (1t2r A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 461193Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 461881Superfamily b.34.14: PAZ domain [101690] (1 family) (S)
  5. 461882Family b.34.14.1: PAZ domain [101691] (4 proteins)
  6. 461886Protein Argonaute 2 [101692] (1 species)
  7. 461887Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101693] (4 PDB entries)
  8. 461889Domain d1t2ra_: 1t2r A: [106286]

Details for d1t2ra_

PDB Entry: 1t2r (more details)

PDB Description: structural basis for 3' end recognition of nucleic acids by the drosophila argonaute 2 paz domain

SCOP Domain Sequences for d1t2ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t2ra_ b.34.14.1 (A:) Argonaute 2 {Fruit fly (Drosophila melanogaster)}
gamampmieylerfslkakinnttnldysrrflepflrginvvytppqsfqsaprvyrvn
glsrapassetfehdgkkvtiasyfhsrnyplkfpqlhclnvgssiksillpielcsiee
gqa

SCOP Domain Coordinates for d1t2ra_:

Click to download the PDB-style file with coordinates for d1t2ra_.
(The format of our PDB-style files is described here.)

Timeline for d1t2ra_: