![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.14: PAZ domain [101690] (2 families) ![]() |
![]() | Family b.34.14.1: PAZ domain [101691] (6 proteins) |
![]() | Protein Argonaute 2 [101692] (2 species) Pfam PF16486; Pfam PF08699; Pfam PF16488 |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101693] (4 PDB entries) Uniprot Q9VUQ5 602-717 ! Uniprot Q9VUQ5 602-720 |
![]() | Domain d1t2ra1: 1t2r A:5-123 [106286] Other proteins in same PDB: d1t2ra2 protein/RNA complex |
PDB Entry: 1t2r (more details)
SCOPe Domain Sequences for d1t2ra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t2ra1 b.34.14.1 (A:5-123) Argonaute 2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} mpmieylerfslkakinnttnldysrrflepflrginvvytppqsfqsaprvyrvnglsr apassetfehdgkkvtiasyfhsrnyplkfpqlhclnvgssiksillpielcsieegqa
Timeline for d1t2ra1: