Lineage for d1t2pc_ (1t2p C:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2409175Fold b.100: Sortase [63816] (1 superfamily)
    barrel, closed; n=8, S=10; mixed sheet; two overside connections
  4. 2409176Superfamily b.100.1: Sortase [63817] (2 families) (S)
  5. 2409177Family b.100.1.1: Sortase [63818] (3 protein domains)
  6. 2409183Protein Sortase A [63819] (1 species)
  7. 2409184Species Staphylococcus aureus [TaxId:1280] [63820] (5 PDB entries)
    Uniprot Q9S446 61-206
  8. 2409190Domain d1t2pc_: 1t2p C: [106285]

Details for d1t2pc_

PDB Entry: 1t2p (more details), 2 Å

PDB Description: Crystal structure of Sortase A from Staphylococcus aureus
PDB Compounds: (C:) Sortase

SCOPe Domain Sequences for d1t2pc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t2pc_ b.100.1.1 (C:) Sortase A {Staphylococcus aureus [TaxId: 1280]}
kpqipkdkskvagyieipdadikepvypgpatpeqlnrgvsfaeeneslddqnisiaght
fidrpnyqftnlkaakkgsmvyfkvgnetrkykmtsirdvkptdvgvldeqkgkdkqltl
itcddynektgvwekrkifvatevk

SCOPe Domain Coordinates for d1t2pc_:

Click to download the PDB-style file with coordinates for d1t2pc_.
(The format of our PDB-style files is described here.)

Timeline for d1t2pc_: