SCOPe 2.01: Domain d1t2oc_: 1t2o C:

Lineage for d1t2oc_ (1t2o C:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.100: Sortase [63816] (1 superfamily)
   barrel, closed; n=8, S=10; mixed sheet; two overside connections

4. Superfamily b.100.1: Sortase [63817] (1 family)

5. Family b.100.1.1: Sortase [63818] (3 proteins)

6. Protein Sortase A [63819] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [63820] (4 PDB entries)
   Uniprot Q9S446 61-206

8. Domain d1t2oc_: 1t2o C: [106282]

Details for d1t2oc_

PDB Entry: 1t2o, 2.3 Å

PDB Description: crystal structure of se-srta, c184-ala

PDB Compounds: (C:) Sortase

SCOPe Domain Sequences for d1t2oc_:

Sequence; same for both SEQRES and ATOM records:

>d1t2oc_ b.100.1.1 (C:) Sortase A {Staphylococcus aureus [TaxId: 1280]}
pqipkdkskvagyieipdadikepvypgpatpeqlnrgvsfaeeneslddqnisiaghtf
idrpnyqftnlkaakkgsmvyfkvgnetrkykmtsirdvkptdvgvldeqkgkdkqltli
taddynektgvwekrkifvatevk

Timeline for d1t2oc_:

• d1t2oc_ first appeared in SCOP 1.69
  
• d1t2oc_ appears in SCOP 1.75
  
• d1t2oc_ appears in SCOPe 2.02
  
• d1t2oc_ appears in the current release, SCOPe 2.08