Lineage for d1t2ob_ (1t2o B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2074754Fold b.100: Sortase [63816] (1 superfamily)
    barrel, closed; n=8, S=10; mixed sheet; two overside connections
  4. 2074755Superfamily b.100.1: Sortase [63817] (2 families) (S)
  5. 2074756Family b.100.1.1: Sortase [63818] (3 protein domains)
  6. 2074762Protein Sortase A [63819] (1 species)
  7. 2074763Species Staphylococcus aureus [TaxId:1280] [63820] (5 PDB entries)
    Uniprot Q9S446 61-206
  8. 2074771Domain d1t2ob_: 1t2o B: [106281]

Details for d1t2ob_

PDB Entry: 1t2o (more details), 2.3 Å

PDB Description: Crystal structure of Se-SrtA, C184-Ala
PDB Compounds: (B:) Sortase

SCOPe Domain Sequences for d1t2ob_:

Sequence, based on SEQRES records: (download)

>d1t2ob_ b.100.1.1 (B:) Sortase A {Staphylococcus aureus [TaxId: 1280]}
qipkdkskvagyieipdadikepvypgpatpeqlnrgvsfaeeneslddqnisiaghtfi
drpnyqftnlkaakkgsmvyfkvgnetrkykmtsirdvkptdvgvldeqkgkdkqltlit
addynektgvwekrkifvatev

Sequence, based on observed residues (ATOM records): (download)

>d1t2ob_ b.100.1.1 (B:) Sortase A {Staphylococcus aureus [TaxId: 1280]}
qipkdkskvagyieipdadikepvypgpatpeqlnrgvsfaeeneslddqnisiaghtfi
drpnyqftnlkaakkgsmvyfkvgnetrkykmtsirdvkptdvgvkgkdkqltlitaddy
nektgvwekrkifvatev

SCOPe Domain Coordinates for d1t2ob_:

Click to download the PDB-style file with coordinates for d1t2ob_.
(The format of our PDB-style files is described here.)

Timeline for d1t2ob_: