Lineage for d1t2oa_ (1t2o A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2820736Fold b.100: Sortase [63816] (1 superfamily)
    barrel, closed; n=8, S=10; mixed sheet; two overside connections
  4. 2820737Superfamily b.100.1: Sortase [63817] (2 families) (S)
  5. 2820738Family b.100.1.1: Sortase [63818] (3 proteins)
  6. 2820744Protein Sortase A [63819] (2 species)
  7. 2820745Species Staphylococcus aureus [TaxId:1280] [63820] (5 PDB entries)
    Uniprot Q9S446 61-206
  8. 2820752Domain d1t2oa_: 1t2o A: [106280]

Details for d1t2oa_

PDB Entry: 1t2o (more details), 2.3 Å

PDB Description: crystal structure of se-srta, c184-ala
PDB Compounds: (A:) Sortase

SCOPe Domain Sequences for d1t2oa_:

Sequence, based on SEQRES records: (download)

>d1t2oa_ b.100.1.1 (A:) Sortase A {Staphylococcus aureus [TaxId: 1280]}
akpqipkdkskvagyieipdadikepvypgpatpeqlnrgvsfaeeneslddqnisiagh
tfidrpnyqftnlkaakkgsmvyfkvgnetrkykmtsirdvkptdvgvldeqkgkdkqlt
litaddynektgvwekrkifvatevk

Sequence, based on observed residues (ATOM records): (download)

>d1t2oa_ b.100.1.1 (A:) Sortase A {Staphylococcus aureus [TaxId: 1280]}
akpqipkdkskvagyieipdadikepvypgpatpeqlnrgvsfaeeneslddqnisiagh
tfidrpnyqftnlkaakkgsmvyfkvgnetrkykmtsirdvkptdvgvlkgkdkqltlit
addynektgvwekrkifvatevk

SCOPe Domain Coordinates for d1t2oa_:

Click to download the PDB-style file with coordinates for d1t2oa_.
(The format of our PDB-style files is described here.)

Timeline for d1t2oa_: