SCOPe 2.05: Domain d1t1vb_: 1t1v B:

Lineage for d1t1vb_ (1t1v B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.14: SH3BGR (SH3-binding, glutamic acid-rich protein-like) [102446] (2 proteins)
   related to glutaredoxin 1 (GRX1) but lacks both conserved cysteine residues
   automatically mapped to Pfam PF04908

6. Protein SH3BGRL3 [102447] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [102448] (2 PDB entries)
   Uniprot Q91VW3

8. Domain d1t1vb_: 1t1v B: [106279]
   complexed with acy, gol, so4

Details for d1t1vb_

PDB Entry: 1t1v, 1.6 Å

PDB Description: Crystal Structure of the Glutaredoxin-like Protein SH3BGRL3 at 1.6 A resolution

PDB Compounds: (B:) SH3 domain-binding glutamic acid-rich protein-like 3

SCOPe Domain Sequences for d1t1vb_:

Sequence; same for both SEQRES and ATOM records:

>d1t1vb_ c.47.1.14 (B:) SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]}
msglrvystsvtgsreiksqqsevtrildgkriqyqlvdisqdnalrdemrtlagnpkat
ppqivngnhycgdyelfveaveqdtlqeflkla

Timeline for d1t1vb_:

• d1t1vb_ first appeared in SCOP 1.69
  
• d1t1vb_ appears in SCOPe 2.04
  
• d1t1vb_ appears in SCOPe 2.06
  
• d1t1vb_ appears in the current release, SCOPe 2.08