SCOP 1.71: Domain d1t1sb1: 1t1s B:301-397

Lineage for d1t1sb1 (1t1s B:301-397)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.69: Left-handed superhelix [47916] (3 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.3: 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain [69055] (1 family)

5. Family a.69.3.1: 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain [69056] (1 protein)

6. Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain [69057] (2 species)

7. Species Escherichia coli [TaxId:562] [69058] (10 PDB entries)

8. Domain d1t1sb1: 1t1s B:301-397 [106274]
   Other proteins in same PDB: d1t1sa2, d1t1sa3, d1t1sa4, d1t1sb2, d1t1sb3, d1t1sb4
   complexed with cbq, mg, so4

Details for d1t1sb1

PDB Entry: 1t1s, 2.4 Å

PDB Description: Crystal Structure of the Reductoisomerase Complexed with a Bisphosphonate

SCOP Domain Sequences for d1t1sb1:

Sequence; same for both SEQRES and ATOM records:

>d1t1sb1 a.69.3.1 (B:301-397) 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain {Escherichia coli}
lsaltfaapdydrypclklameafeqgqaattalnaaneitvaaflaqqirftdiaalnl
svlekmdmrepqcvddvlsvdanarevarkevmrlas

Timeline for d1t1sb1:

• d1t1sb1 first appeared in SCOP 1.69
  
• d1t1sb1 appears in SCOP 1.73
  
• d1t1sb1 appears in the current release, SCOPe 2.08