Lineage for d1t1sb1 (1t1s B:301-397)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 445008Fold a.69: Left-handed superhelix [47916] (3 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 445107Superfamily a.69.3: 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain [69055] (1 family) (S)
  5. 445108Family a.69.3.1: 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain [69056] (1 protein)
  6. 445109Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain [69057] (2 species)
  7. 445110Species Escherichia coli [TaxId:562] [69058] (10 PDB entries)
  8. 445117Domain d1t1sb1: 1t1s B:301-397 [106274]
    Other proteins in same PDB: d1t1sa2, d1t1sa3, d1t1sa4, d1t1sb2, d1t1sb3, d1t1sb4

Details for d1t1sb1

PDB Entry: 1t1s (more details), 2.4 Å

PDB Description: Crystal Structure of the Reductoisomerase Complexed with a Bisphosphonate

SCOP Domain Sequences for d1t1sb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t1sb1 a.69.3.1 (B:301-397) 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain {Escherichia coli}
lsaltfaapdydrypclklameafeqgqaattalnaaneitvaaflaqqirftdiaalnl
svlekmdmrepqcvddvlsvdanarevarkevmrlas

SCOP Domain Coordinates for d1t1sb1:

Click to download the PDB-style file with coordinates for d1t1sb1.
(The format of our PDB-style files is described here.)

Timeline for d1t1sb1: