Lineage for d1t1sb1 (1t1s B:301-397)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717308Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2717707Superfamily a.69.3: 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain [69055] (1 family) (S)
  5. 2717708Family a.69.3.1: 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain [69056] (1 protein)
  6. 2717709Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain [69057] (2 species)
  7. 2717710Species Escherichia coli [TaxId:562] [69058] (11 PDB entries)
    Uniprot P45568
  8. 2717718Domain d1t1sb1: 1t1s B:301-397 [106274]
    Other proteins in same PDB: d1t1sa2, d1t1sa3, d1t1sa4, d1t1sa5, d1t1sb2, d1t1sb3, d1t1sb4, d1t1sb5
    complexed with cbq, mg, so4

Details for d1t1sb1

PDB Entry: 1t1s (more details), 2.4 Å

PDB Description: Crystal Structure of the Reductoisomerase Complexed with a Bisphosphonate
PDB Compounds: (B:) 1-deoxy-D-xylulose 5-phosphate reductoisomerase

SCOPe Domain Sequences for d1t1sb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t1sb1 a.69.3.1 (B:301-397) 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain {Escherichia coli [TaxId: 562]}
lsaltfaapdydrypclklameafeqgqaattalnaaneitvaaflaqqirftdiaalnl
svlekmdmrepqcvddvlsvdanarevarkevmrlas

SCOPe Domain Coordinates for d1t1sb1:

Click to download the PDB-style file with coordinates for d1t1sb1.
(The format of our PDB-style files is described here.)

Timeline for d1t1sb1: