![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
![]() | Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase [69410] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [69411] (11 PDB entries) Uniprot P45568 |
![]() | Domain d1t1sa2: 1t1s A:1-125 [106271] Other proteins in same PDB: d1t1sa1, d1t1sa4, d1t1sa5, d1t1sb1, d1t1sb4, d1t1sb5 complexed with cbq, mg, so4 |
PDB Entry: 1t1s (more details), 2.4 Å
SCOPe Domain Sequences for d1t1sa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t1sa2 c.2.1.3 (A:1-125) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} kqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefspryavmddeas akllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllptlaairagktil lanke
Timeline for d1t1sa2: