| Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) ![]() |
| Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (17 proteins) family members also share a common alpha+beta fold in C-terminal domain |
| Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase [69410] (2 species) |
| Species Escherichia coli [TaxId:562] [69411] (10 PDB entries) |
| Domain d1t1ra2: 1t1r A:1-125 [106263] Other proteins in same PDB: d1t1ra1, d1t1ra4, d1t1rb1, d1t1rb4 |
PDB Entry: 1t1r (more details), 2.3 Å
SCOP Domain Sequences for d1t1ra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t1ra2 c.2.1.3 (A:1-125) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli}
kqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefspryavmddeas
akllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllptlaairagktil
lanke
Timeline for d1t1ra2:
View in 3DDomains from other chains: (mouse over for more information) d1t1rb1, d1t1rb2, d1t1rb3, d1t1rb4 |