Lineage for d1t1p.1 (1t1p B:,A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029609Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 3029610Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 3029611Family g.1.1.1: Insulin-like [56995] (5 proteins)
  6. 3029616Protein Insulin [56996] (3 species)
  7. 3029626Species Human (Homo sapiens) [TaxId:9606] [56998] (63 PDB entries)
    Uniprot P01308
  8. 3029771Domain d1t1p.1: 1t1p B:,A: [106260]
    mutant

Details for d1t1p.1

PDB Entry: 1t1p (more details)

PDB Description: nmr structure of human insulin mutant his-b10-asp, val-b12-thr, pro- b28-lys, lys-b29-pro, 15 structures
PDB Compounds: (A:) insulin, (B:) insulin

SCOPe Domain Sequences for d1t1p.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1t1p.1 g.1.1.1 (B:,A:) Insulin {Human (Homo sapiens) [TaxId: 9606]}
fvnqhlcgsdltealylvcgergffytkptXgiveqcctsicslyqlenycn

SCOPe Domain Coordinates for d1t1p.1:

Click to download the PDB-style file with coordinates for d1t1p.1.
(The format of our PDB-style files is described here.)

Timeline for d1t1p.1: