Lineage for d1t1mc_ (1t1m C:)

  1. Root: SCOPe 2.04
  2. 1710350Class i: Low resolution protein structures [58117] (25 folds)
  3. 1710351Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1710352Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1710353Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1710354Protein 70S ribosome functional complex [58121] (9 species)
  7. 1710427Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 1710552Domain d1t1mc_: 1t1m C: [106256]
    RRF-binding site

Details for d1t1mc_

PDB Entry: 1t1m (more details), 12 Å

PDB Description: Binding position of ribosome recycling factor (RRF) on the E. coli 70S ribosome
PDB Compounds: (C:) ribosome recycling factor

SCOPe Domain Sequences for d1t1mc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t1mc_ i.1.1.1 (C:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
vnpfikeakekmkrtlekiedelrkmrtgkpspaileeikvdyygvptpvnqlatisise
ertlvikpwdksvlsliekainasdlglnpindgnvirlvfpsptteqrekwvkkakeiv
eegkiairnirreilkkikedqkeglipeddakrleneiqkltdefiekldevfeikkee
imef

SCOPe Domain Coordinates for d1t1mc_:

Click to download the PDB-style file with coordinates for d1t1mc_.
(The format of our PDB-style files is described here.)

Timeline for d1t1mc_: